$ cat recipes/field-market-day-japanese-corn-pepper-smoothie-stack-041179.md

Field Market-Day Japanese Corn Pepper Smoothie Stack

Name: Field Market-Day Japanese Corn Pepper Smoothie Stack
Prep time: 10 min
Cook time: 24 min
Total time: 34 min
Yield: 5 servings
Ingredients: field market-day japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Market-Day Japanese Corn Pepper Smoothie Stack is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Market-Day Japanese Corn Pepper Smoothie Stack

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       10 min
cook       24 min
total      34 min
servings   5
protein    13 g
pantry     89/100

categorybreakfastdietpescatarianleveleasykcal366

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field market-day japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.