$ cat recipes/field-market-day-korean-sweet-potato-toast-stack-041074.md

Field Market-Day Korean Sweet Potato Toast Stack

Name: Field Market-Day Korean Sweet Potato Toast Stack
Prep time: 25 min
Cook time: 11 min
Total time: 36 min
Yield: 5 servings
Ingredients: field market-day korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Market-Day Korean Sweet Potato Toast Stack is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

runnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Market-Day Korean Sweet Potato Toast Stack

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       25 min
cook       11 min
total      36 min
servings   5
protein    20 g
pantry     82/100

categorybreakfastdietpescatarianleveleasykcal401

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field market-day korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.