$ cat recipes/field-market-day-mediterranean-miso-scallion-scramble-cup-040889.md

Field Market-Day Mediterranean Miso Scallion Scramble Cup

Name: Field Market-Day Mediterranean Miso Scallion Scramble Cup
Prep time: 20 min
Cook time: 8 min
Total time: 28 min
Yield: 5 servings
Ingredients: field market-day mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Market-Day Mediterranean Miso Scallion Scramble Cup is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

runnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Market-Day Mediterranean Miso Scallion Scramble Cup

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       20 min
cook       8 min
total      28 min
servings   5
protein    7 g
pantry     97/100

categorybreakfastdietpescatarianleveleasykcal416

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field market-day mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.