$ cat recipes/field-market-day-mexican-garlic-butter-scramble-cup-040384.md

Field Market-Day Mexican Garlic Butter Scramble Cup

Name: Field Market-Day Mexican Garlic Butter Scramble Cup
Prep time: 23 min
Cook time: 45 min
Total time: 68 min
Yield: 5 servings
Ingredients: field market-day mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Market-Day Mexican Garlic Butter Scramble Cup is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Field Market-Day Mexican Garlic Butter Scramble Cup

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       23 min
cook       45 min
total      68 min
servings   5
protein    28 g
pantry     77/100

categorybreakfastdietpescatarianlevelmediumkcal351

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field market-day mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.