$ cat recipes/field-market-day-ontario-miso-scallion-yogurt-cup-stack-041979.md

Field Market-Day Ontario Miso Scallion Yogurt Cup Stack

Name: Field Market-Day Ontario Miso Scallion Yogurt Cup Stack
Prep time: 12 min
Cook time: 38 min
Total time: 50 min
Yield: 5 servings
Ingredients: field market-day ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Market-Day Ontario Miso Scallion Yogurt Cup Stack is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Market-Day Ontario Miso Scallion Yogurt Cup Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       12 min
cook       38 min
total      50 min
servings   5
protein    23 g
pantry     74/100

categorybreakfastdietpescatarianleveleasykcal566

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field market-day ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.