$ cat recipes/field-rainy-day-brazilian-miso-scallion-yogurt-cup-stack-042424.md

Field Rainy-Day Brazilian Miso Scallion Yogurt Cup Stack

Name: Field Rainy-Day Brazilian Miso Scallion Yogurt Cup Stack
Prep time: 27 min
Cook time: 37 min
Total time: 64 min
Yield: 5 servings
Ingredients: field rainy-day brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Rainy-Day Brazilian Miso Scallion Yogurt Cup Stack is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Field Rainy-Day Brazilian Miso Scallion Yogurt Cup Stack

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       27 min
cook       37 min
total      64 min
servings   5
protein    44 g
pantry     90/100

categorybreakfastdietpescatarianleveleasykcal371

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field rainy-day brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.