$ cat recipes/field-rainy-day-french-spinach-feta-oat-stack-047774.md

Field Rainy-Day French Spinach Feta Oat Stack

Name: Field Rainy-Day French Spinach Feta Oat Stack
Prep time: 17 min
Cook time: 19 min
Total time: 36 min
Yield: 5 servings
Ingredients: field rainy-day french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Rainy-Day French Spinach Feta Oat Stack is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Field Rainy-Day French Spinach Feta Oat Stack

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       17 min
cook       19 min
total      36 min
servings   5
protein    42 g
pantry     64/100

categorybreakfastdietpescatarianleveleasykcal361

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field rainy-day french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.