$ cat recipes/field-rainy-day-ontario-corn-pepper-breakfast-wrap-plate-043719.md

Field Rainy-Day Ontario Corn Pepper Breakfast Wrap Plate

Name: Field Rainy-Day Ontario Corn Pepper Breakfast Wrap Plate
Prep time: 18 min
Cook time: 20 min
Total time: 38 min
Yield: 5 servings
Ingredients: field rainy-day ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Rainy-Day Ontario Corn Pepper Breakfast Wrap Plate is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Rainy-Day Ontario Corn Pepper Breakfast Wrap Plate

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       18 min
cook       20 min
total      38 min
servings   5
protein    21 g
pantry     67/100

categorybreakfastdietpescatarianleveleasykcal266

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field rainy-day ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.