$ cat recipes/field-rainy-day-taiwanese-sesame-ginger-pancake-hash-040944.md

Field Rainy-Day Taiwanese Sesame Ginger Pancake Hash

Name: Field Rainy-Day Taiwanese Sesame Ginger Pancake Hash
Prep time: 9 min
Cook time: 13 min
Total time: 22 min
Yield: 5 servings
Ingredients: field rainy-day taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Rainy-Day Taiwanese Sesame Ginger Pancake Hash is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Rainy-Day Taiwanese Sesame Ginger Pancake Hash

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       9 min
cook       13 min
total      22 min
servings   5
protein    16 g
pantry     87/100

categorybreakfastdietpescatarianlevelmediumkcal491

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field rainy-day taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.