$ cat recipes/field-spring-indian-spinach-feta-pancake-bake-041409.md

Field Spring Indian Spinach Feta Pancake Bake

Name: Field Spring Indian Spinach Feta Pancake Bake
Prep time: 18 min
Cook time: 38 min
Total time: 56 min
Yield: 5 servings
Ingredients: field spring indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Spring Indian Spinach Feta Pancake Bake is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Spring Indian Spinach Feta Pancake Bake

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       18 min
cook       38 min
total      56 min
servings   5
protein    23 g
pantry     77/100

categorybreakfastdietpescatarianleveleasykcal546

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field spring indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.