$ cat recipes/field-spring-japanese-sweet-potato-yogurt-cup-cup-048434.md

Field Spring Japanese Sweet Potato Yogurt Cup Cup

Name: Field Spring Japanese Sweet Potato Yogurt Cup Cup
Prep time: 17 min
Cook time: 41 min
Total time: 58 min
Yield: 5 servings
Ingredients: field spring japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Spring Japanese Sweet Potato Yogurt Cup Cup is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Field Spring Japanese Sweet Potato Yogurt Cup Cup

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       17 min
cook       41 min
total      58 min
servings   5
protein    36 g
pantry     67/100

categorybreakfastdietpescatarianlevelmediumkcal281

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field spring japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.