$ cat recipes/field-spring-korean-lemon-herb-egg-muffin-bake-041009.md

Field Spring Korean Lemon Herb Egg Muffin Bake

Name: Field Spring Korean Lemon Herb Egg Muffin Bake
Prep time: 6 min
Cook time: 12 min
Total time: 18 min
Yield: 5 servings
Ingredients: field spring korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Spring Korean Lemon Herb Egg Muffin Bake is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Field Spring Korean Lemon Herb Egg Muffin Bake

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       6 min
cook       12 min
total      18 min
servings   5
protein    37 g
pantry     64/100

categorybreakfastdietpescatarianleveleasykcal446

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field spring korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.