$ cat recipes/field-spring-mexican-tomato-basil-oat-bake-041209.md

Field Spring Mexican Tomato Basil Oat Bake

Name: Field Spring Mexican Tomato Basil Oat Bake
Prep time: 12 min
Cook time: 44 min
Total time: 56 min
Yield: 5 servings
Ingredients: field spring mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Spring Mexican Tomato Basil Oat Bake is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Spring Mexican Tomato Basil Oat Bake

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       12 min
cook       44 min
total      56 min
servings   5
protein    11 g
pantry     91/100

categorybreakfastdietpescatarianleveleasykcal496

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field spring mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.