$ cat recipes/field-spring-ontario-sweet-potato-egg-hash-047349.md

Field Spring Ontario Sweet Potato Egg Hash

Name: Field Spring Ontario Sweet Potato Egg Hash
Prep time: 18 min
Cook time: 8 min
Total time: 26 min
Yield: 5 servings
Ingredients: field spring ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Spring Ontario Sweet Potato Egg Hash is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Spring Ontario Sweet Potato Egg Hash

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       18 min
cook       8 min
total      26 min
servings   5
protein    7 g
pantry     63/100

categorybreakfastdietpescatarianlevelmediumkcal316

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field spring ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.