$ cat recipes/field-spring-taiwanese-lemon-herb-yogurt-cup-plate-040919.md

Field Spring Taiwanese Lemon Herb Yogurt Cup Plate

Name: Field Spring Taiwanese Lemon Herb Yogurt Cup Plate
Prep time: 22 min
Cook time: 28 min
Total time: 50 min
Yield: 5 servings
Ingredients: field spring taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Spring Taiwanese Lemon Herb Yogurt Cup Plate is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Field Spring Taiwanese Lemon Herb Yogurt Cup Plate

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       22 min
cook       28 min
total      50 min
servings   5
protein    43 g
pantry     58/100

categorybreakfastdietpescatarianleveleasykcal546

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field spring taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.