$ cat recipes/field-sunday-brazilian-coconut-lime-smoothie-hash-040694.md

Field Sunday Brazilian Coconut Lime Smoothie Hash

Name: Field Sunday Brazilian Coconut Lime Smoothie Hash
Prep time: 7 min
Cook time: 11 min
Total time: 18 min
Yield: 5 servings
Ingredients: field sunday brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Sunday Brazilian Coconut Lime Smoothie Hash is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Sunday Brazilian Coconut Lime Smoothie Hash

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       7 min
cook       11 min
total      18 min
servings   5
protein    20 g
pantry     84/100

categorybreakfastdietpescatarianleveleasykcal551

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field sunday brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.