$ cat recipes/field-sunday-indian-lemon-herb-egg-stack-042379.md

Field Sunday Indian Lemon Herb Egg Stack

Name: Field Sunday Indian Lemon Herb Egg Stack
Prep time: 24 min
Cook time: 26 min
Total time: 50 min
Yield: 5 servings
Ingredients: field sunday indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Sunday Indian Lemon Herb Egg Stack is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Sunday Indian Lemon Herb Egg Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       24 min
cook       26 min
total      50 min
servings   5
protein    9 g
pantry     87/100

categorybreakfastdietpescatarianlevelmediumkcal666

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field sunday indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.