$ cat recipes/field-sunday-korean-tomato-basil-breakfast-wrap-bake-044759.md

Field Sunday Korean Tomato Basil Breakfast Wrap Bake

Name: Field Sunday Korean Tomato Basil Breakfast Wrap Bake
Prep time: 14 min
Cook time: 42 min
Total time: 56 min
Yield: 5 servings
Ingredients: field sunday korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Sunday Korean Tomato Basil Breakfast Wrap Bake is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Sunday Korean Tomato Basil Breakfast Wrap Bake

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       14 min
cook       42 min
total      56 min
servings   5
protein    15 g
pantry     68/100

categorybreakfastdietpescatarianlevelmediumkcal526

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field sunday korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.