$ cat recipes/field-sunday-mediterranean-sweet-potato-egg-hash-045349.md

Field Sunday Mediterranean Sweet Potato Egg Hash

Name: Field Sunday Mediterranean Sweet Potato Egg Hash
Prep time: 24 min
Cook time: 30 min
Total time: 54 min
Yield: 5 servings
Ingredients: field sunday mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Sunday Mediterranean Sweet Potato Egg Hash is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Field Sunday Mediterranean Sweet Potato Egg Hash

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       24 min
cook       30 min
total      54 min
servings   5
protein    39 g
pantry     80/100

categorybreakfastdietpescatarianleveleasykcal306

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field sunday mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.