$ cat recipes/field-sunday-mexican-spinach-feta-pancake-bake-044954.md

Field Sunday Mexican Spinach Feta Pancake Bake

Name: Field Sunday Mexican Spinach Feta Pancake Bake
Prep time: 27 min
Cook time: 39 min
Total time: 66 min
Yield: 5 servings
Ingredients: field sunday mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Sunday Mexican Spinach Feta Pancake Bake is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Field Sunday Mexican Spinach Feta Pancake Bake

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       27 min
cook       39 min
total      66 min
servings   5
protein    40 g
pantry     81/100

categorybreakfastdietpescatarianleveleasykcal391

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field sunday mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.