$ cat recipes/field-winter-british-sweet-potato-oat-bake-040704.md

Field Winter British Sweet Potato Oat Bake

Name: Field Winter British Sweet Potato Oat Bake
Prep time: 15 min
Cook time: 43 min
Total time: 58 min
Yield: 5 servings
Ingredients: field winter british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Winter British Sweet Potato Oat Bake is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Field Winter British Sweet Potato Oat Bake

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       15 min
cook       43 min
total      58 min
servings   5
protein    32 g
pantry     71/100

categorybreakfastdietpescatarianleveleasykcal431

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field winter british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.