$ cat recipes/field-winter-korean-garlic-butter-overnight-oat-bake-040104.md

Field Winter Korean Garlic Butter Overnight Oat Bake

Name: Field Winter Korean Garlic Butter Overnight Oat Bake
Prep time: 19 min
Cook time: 23 min
Total time: 42 min
Yield: 5 servings
Ingredients: field winter korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Winter Korean Garlic Butter Overnight Oat Bake is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Field Winter Korean Garlic Butter Overnight Oat Bake

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       19 min
cook       23 min
total      42 min
servings   5
protein    34 g
pantry     72/100

categorybreakfastdietpescatarianlevelmediumkcal281

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field winter korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.