$ cat recipes/field-winter-taiwanese-sesame-ginger-smoothie-stack-043674.md

Field Winter Taiwanese Sesame Ginger Smoothie Stack

Name: Field Winter Taiwanese Sesame Ginger Smoothie Stack
Prep time: 15 min
Cook time: 9 min
Total time: 24 min
Yield: 5 servings
Ingredients: field winter taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Field Winter Taiwanese Sesame Ginger Smoothie Stack is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Winter Taiwanese Sesame Ginger Smoothie Stack

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       15 min
cook       9 min
total      24 min
servings   5
protein    24 g
pantry     64/100

categorybreakfastdietpescatarianlevelmediumkcal561

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field winter taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.