$ cat recipes/field-winter-taiwanese-sweet-potato-egg-hash-046349.md

Field Winter Taiwanese Sweet Potato Egg Hash

Name: Field Winter Taiwanese Sweet Potato Egg Hash
Prep time: 10 min
Cook time: 38 min
Total time: 48 min
Yield: 5 servings
Ingredients: field winter taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Field Winter Taiwanese Sweet Potato Egg Hash is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Field Winter Taiwanese Sweet Potato Egg Hash

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       38 min
total      48 min
servings   5
protein    23 g
pantry     92/100

categorybreakfastdietpescatarianleveleasykcal556

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

field winter taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.