$ cat recipes/greenhouse-holiday-british-corn-pepper-toast-cup-112539.md

Greenhouse Holiday British Corn Pepper Toast Cup

Name: Greenhouse Holiday British Corn Pepper Toast Cup
Prep time: 8 min
Cook time: 34 min
Total time: 42 min
Yield: 5 servings
Ingredients: greenhouse holiday british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Greenhouse Holiday British Corn Pepper Toast Cup is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Greenhouse Holiday British Corn Pepper Toast Cup

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       8 min
cook       34 min
total      42 min
servings   5
protein    31 g
pantry     63/100

categorybreakfastdietpescatarianleveleasykcal566

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

greenhouse holiday british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.