$ cat recipes/greenhouse-late-night-korean-pesto-kale-breakfast-wrap-stack-114729.md

Greenhouse Late-Night Korean Pesto Kale Breakfast Wrap Stack

Name: Greenhouse Late-Night Korean Pesto Kale Breakfast Wrap Stack
Prep time: 22 min
Cook time: 12 min
Total time: 34 min
Yield: 5 servings
Ingredients: greenhouse late-night korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Greenhouse Late-Night Korean Pesto Kale Breakfast Wrap Stack is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Greenhouse Late-Night Korean Pesto Kale Breakfast Wrap Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       22 min
cook       12 min
total      34 min
servings   5
protein    37 g
pantry     86/100

categorybreakfastdietpescatarianleveleasykcal256

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

greenhouse late-night korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.