$ cat recipes/greenhouse-lunchbox-french-garlic-butter-yogurt-cup-stack-115929.md

Greenhouse Lunchbox French Garlic Butter Yogurt Cup Stack

Name: Greenhouse Lunchbox French Garlic Butter Yogurt Cup Stack
Prep time: 14 min
Cook time: 14 min
Total time: 28 min
Yield: 5 servings
Ingredients: greenhouse lunchbox french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Greenhouse Lunchbox French Garlic Butter Yogurt Cup Stack is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Greenhouse Lunchbox French Garlic Butter Yogurt Cup Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       14 min
cook       14 min
total      28 min
servings   5
protein    33 g
pantry     84/100

categorybreakfastdietpescatarianleveleasykcal556

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

greenhouse lunchbox french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.