$ cat recipes/greenhouse-lunchbox-indian-lemon-herb-pancake-plate-116914.md

Greenhouse Lunchbox Indian Lemon Herb Pancake Plate

Name: Greenhouse Lunchbox Indian Lemon Herb Pancake Plate
Prep time: 21 min
Cook time: 31 min
Total time: 52 min
Yield: 5 servings
Ingredients: greenhouse lunchbox indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Greenhouse Lunchbox Indian Lemon Herb Pancake Plate is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Greenhouse Lunchbox Indian Lemon Herb Pancake Plate

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       21 min
cook       31 min
total      52 min
servings   5
protein    18 g
pantry     95/100

categorybreakfastdietpescatarianleveleasykcal251

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

greenhouse lunchbox indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.