$ cat recipes/greenhouse-rainy-day-indian-sweet-potato-pancake-cup-111439.md

Greenhouse Rainy-Day Indian Sweet Potato Pancake Cup

Name: Greenhouse Rainy-Day Indian Sweet Potato Pancake Cup
Prep time: 8 min
Cook time: 10 min
Total time: 18 min
Yield: 5 servings
Ingredients: greenhouse rainy-day indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Greenhouse Rainy-Day Indian Sweet Potato Pancake Cup is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Greenhouse Rainy-Day Indian Sweet Potato Pancake Cup

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       8 min
cook       10 min
total      18 min
servings   5
protein    41 g
pantry     58/100

categorybreakfastdietpescatarianleveleasykcal536

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

greenhouse rainy-day indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.