$ cat recipes/greenhouse-spring-mediterranean-sweet-potato-breakfast-wrap-bake-111709.md

Greenhouse Spring Mediterranean Sweet Potato Breakfast Wrap Bake

Name: Greenhouse Spring Mediterranean Sweet Potato Breakfast Wrap Bake
Prep time: 26 min
Cook time: 38 min
Total time: 64 min
Yield: 5 servings
Ingredients: greenhouse spring mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Greenhouse Spring Mediterranean Sweet Potato Breakfast Wrap Bake is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Greenhouse Spring Mediterranean Sweet Potato Breakfast Wrap Bake

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       26 min
cook       38 min
total      64 min
servings   5
protein    23 g
pantry     76/100

categorybreakfastdietpescatarianleveleasykcal236

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

greenhouse spring mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.