$ cat recipes/greenhouse-sunday-korean-corn-pepper-toast-cup-111084.md

Greenhouse Sunday Korean Corn Pepper Toast Cup

Name: Greenhouse Sunday Korean Corn Pepper Toast Cup
Prep time: 21 min
Cook time: 33 min
Total time: 54 min
Yield: 5 servings
Ingredients: greenhouse sunday korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Greenhouse Sunday Korean Corn Pepper Toast Cup is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Greenhouse Sunday Korean Corn Pepper Toast Cup

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       21 min
cook       33 min
total      54 min
servings   5
protein    14 g
pantry     89/100

categorybreakfastdietpescatarianlevelmediumkcal631

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

greenhouse sunday korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.