$ cat recipes/harbor-fall-french-sesame-ginger-breakfast-wrap-plate-027769.md

Harbor Fall French Sesame Ginger Breakfast Wrap Plate

Name: Harbor Fall French Sesame Ginger Breakfast Wrap Plate
Prep time: 18 min
Cook time: 14 min
Total time: 32 min
Yield: 5 servings
Ingredients: harbor fall french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Fall French Sesame Ginger Breakfast Wrap Plate is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Harbor Fall French Sesame Ginger Breakfast Wrap Plate

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       18 min
cook       14 min
total      32 min
servings   5
protein    33 g
pantry     97/100

categorybreakfastdietpescatarianleveleasykcal566

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor fall french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.