$ cat recipes/harbor-fall-japanese-sesame-ginger-overnight-oat-stack-026679.md

Harbor Fall Japanese Sesame Ginger Overnight Oat Stack

Name: Harbor Fall Japanese Sesame Ginger Overnight Oat Stack
Prep time: 26 min
Cook time: 22 min
Total time: 48 min
Yield: 5 servings
Ingredients: harbor fall japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Fall Japanese Sesame Ginger Overnight Oat Stack is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

runnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Fall Japanese Sesame Ginger Overnight Oat Stack

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       26 min
cook       22 min
total      48 min
servings   5
protein    17 g
pantry     79/100

categorybreakfastdietpescatarianleveleasykcal416

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor fall japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.