$ cat recipes/harbor-fall-korean-spinach-feta-overnight-oat-cup-025689.md

Harbor Fall Korean Spinach Feta Overnight Oat Cup

Name: Harbor Fall Korean Spinach Feta Overnight Oat Cup
Prep time: 26 min
Cook time: 8 min
Total time: 34 min
Yield: 5 servings
Ingredients: harbor fall korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Fall Korean Spinach Feta Overnight Oat Cup is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Fall Korean Spinach Feta Overnight Oat Cup

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       26 min
cook       8 min
total      34 min
servings   5
protein    7 g
pantry     95/100

categorybreakfastdietpescatarianleveleasykcal536

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor fall korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.