$ cat recipes/harbor-holiday-british-corn-pepper-toast-cup-027084.md

Harbor Holiday British Corn Pepper Toast Cup

Name: Harbor Holiday British Corn Pepper Toast Cup
Prep time: 9 min
Cook time: 45 min
Total time: 54 min
Yield: 5 servings
Ingredients: harbor holiday british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Harbor Holiday British Corn Pepper Toast Cup is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Harbor Holiday British Corn Pepper Toast Cup

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       9 min
cook       45 min
total      54 min
servings   5
protein    28 g
pantry     65/100

categorybreakfastdietpescatarianlevelmediumkcal211

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor holiday british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.