$ cat recipes/harbor-holiday-indian-miso-scallion-scramble-cup-027889.md

Harbor Holiday Indian Miso Scallion Scramble Cup

Name: Harbor Holiday Indian Miso Scallion Scramble Cup
Prep time: 26 min
Cook time: 18 min
Total time: 44 min
Yield: 5 servings
Ingredients: harbor holiday indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Holiday Indian Miso Scallion Scramble Cup is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Holiday Indian Miso Scallion Scramble Cup

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       26 min
cook       18 min
total      44 min
servings   5
protein    25 g
pantry     64/100

categorybreakfastdietpescatarianlevelmediumkcal596

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor holiday indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.