$ cat recipes/harbor-holiday-taiwanese-spinach-feta-yogurt-cup-bake-025404.md

Harbor Holiday Taiwanese Spinach Feta Yogurt Cup Bake

Name: Harbor Holiday Taiwanese Spinach Feta Yogurt Cup Bake
Prep time: 7 min
Cook time: 27 min
Total time: 34 min
Yield: 5 servings
Ingredients: harbor holiday taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Harbor Holiday Taiwanese Spinach Feta Yogurt Cup Bake is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Holiday Taiwanese Spinach Feta Yogurt Cup Bake

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       7 min
cook       27 min
total      34 min
servings   5
protein    26 g
pantry     76/100

categorybreakfastdietpescatarianlevelmediumkcal281

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor holiday taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.