$ cat recipes/harbor-late-night-british-garlic-butter-overnight-oat-bake-026104.md

Harbor Late-Night British Garlic Butter Overnight Oat Bake

Name: Harbor Late-Night British Garlic Butter Overnight Oat Bake
Prep time: 17 min
Cook time: 25 min
Total time: 42 min
Yield: 5 servings
Ingredients: harbor late-night british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Harbor Late-Night British Garlic Butter Overnight Oat Bake is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Harbor Late-Night British Garlic Butter Overnight Oat Bake

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       17 min
cook       25 min
total      42 min
servings   5
protein    30 g
pantry     68/100

categorybreakfastdietpescatarianlevelmediumkcal211

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor late-night british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.