$ cat recipes/harbor-late-night-british-pesto-kale-egg-muffin-hash-027099.md

Harbor Late-Night British Pesto Kale Egg Muffin Hash

Name: Harbor Late-Night British Pesto Kale Egg Muffin Hash
Prep time: 10 min
Cook time: 36 min
Total time: 46 min
Yield: 5 servings
Ingredients: harbor late-night british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Late-Night British Pesto Kale Egg Muffin Hash is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Late-Night British Pesto Kale Egg Muffin Hash

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       36 min
total      46 min
servings   5
protein    27 g
pantry     66/100

categorybreakfastdietpescatarianleveleasykcal276

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor late-night british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.