$ cat recipes/harbor-late-night-french-corn-pepper-egg-bake-026804.md

Harbor Late-Night French Corn Pepper Egg Bake

Name: Harbor Late-Night French Corn Pepper Egg Bake
Prep time: 27 min
Cook time: 23 min
Total time: 50 min
Yield: 5 servings
Ingredients: harbor late-night french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Harbor Late-Night French Corn Pepper Egg Bake is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Harbor Late-Night French Corn Pepper Egg Bake

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       27 min
cook       23 min
total      50 min
servings   5
protein    34 g
pantry     60/100

categorybreakfastdietpescatarianlevelmediumkcal631

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor late-night french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.