$ cat recipes/harbor-late-night-mediterranean-spinach-feta-scramble-plate-025314.md

Harbor Late-Night Mediterranean Spinach Feta Scramble Plate

Name: Harbor Late-Night Mediterranean Spinach Feta Scramble Plate
Prep time: 23 min
Cook time: 43 min
Total time: 66 min
Yield: 5 servings
Ingredients: harbor late-night mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Harbor Late-Night Mediterranean Spinach Feta Scramble Plate is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Harbor Late-Night Mediterranean Spinach Feta Scramble Plate

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       23 min
cook       43 min
total      66 min
servings   5
protein    32 g
pantry     70/100

categorybreakfastdietpescatarianleveleasykcal381

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor late-night mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.