$ cat recipes/harbor-late-night-taiwanese-sweet-potato-egg-muffin-stack-029079.md

Harbor Late-Night Taiwanese Sweet Potato Egg Muffin Stack

Name: Harbor Late-Night Taiwanese Sweet Potato Egg Muffin Stack
Prep time: 10 min
Cook time: 26 min
Total time: 36 min
Yield: 5 servings
Ingredients: harbor late-night taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Late-Night Taiwanese Sweet Potato Egg Muffin Stack is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Late-Night Taiwanese Sweet Potato Egg Muffin Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       26 min
total      36 min
servings   5
protein    9 g
pantry     75/100

categorybreakfastdietpescatarianlevelmediumkcal526

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor late-night taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.