$ cat recipes/harbor-lunchbox-japanese-coconut-lime-egg-muffin-bake-027504.md

Harbor Lunchbox Japanese Coconut Lime Egg Muffin Bake

Name: Harbor Lunchbox Japanese Coconut Lime Egg Muffin Bake
Prep time: 15 min
Cook time: 21 min
Total time: 36 min
Yield: 5 servings
Ingredients: harbor lunchbox japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Harbor Lunchbox Japanese Coconut Lime Egg Muffin Bake is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Harbor Lunchbox Japanese Coconut Lime Egg Muffin Bake

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       15 min
cook       21 min
total      36 min
servings   5
protein    38 g
pantry     93/100

categorybreakfastdietpescatarianlevelmediumkcal561

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor lunchbox japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.