$ cat recipes/harbor-lunchbox-mexican-spinach-feta-egg-muffin-hash-028594.md

Harbor Lunchbox Mexican Spinach Feta Egg Muffin Hash

Name: Harbor Lunchbox Mexican Spinach Feta Egg Muffin Hash
Prep time: 7 min
Cook time: 13 min
Total time: 20 min
Yield: 5 servings
Ingredients: harbor lunchbox mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Harbor Lunchbox Mexican Spinach Feta Egg Muffin Hash is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Lunchbox Mexican Spinach Feta Egg Muffin Hash

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       7 min
cook       13 min
total      20 min
servings   5
protein    16 g
pantry     70/100

categorybreakfastdietpescatarianleveleasykcal221

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor lunchbox mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.