$ cat recipes/harbor-market-day-brazilian-spinach-feta-smoothie-cup-025139.md

Harbor Market-Day Brazilian Spinach Feta Smoothie Cup

Name: Harbor Market-Day Brazilian Spinach Feta Smoothie Cup
Prep time: 26 min
Cook time: 34 min
Total time: 60 min
Yield: 5 servings
Ingredients: harbor market-day brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Market-Day Brazilian Spinach Feta Smoothie Cup is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Harbor Market-Day Brazilian Spinach Feta Smoothie Cup

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       26 min
cook       34 min
total      60 min
servings   5
protein    31 g
pantry     72/100

categorybreakfastdietpescatarianleveleasykcal276

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor market-day brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.