$ cat recipes/harbor-market-day-korean-coconut-lime-yogurt-cup-plate-027414.md

Harbor Market-Day Korean Coconut Lime Yogurt Cup Plate

Name: Harbor Market-Day Korean Coconut Lime Yogurt Cup Plate
Prep time: 9 min
Cook time: 37 min
Total time: 46 min
Yield: 5 servings
Ingredients: harbor market-day korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Harbor Market-Day Korean Coconut Lime Yogurt Cup Plate is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Harbor Market-Day Korean Coconut Lime Yogurt Cup Plate

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       9 min
cook       37 min
total      46 min
servings   5
protein    44 g
pantry     87/100

categorybreakfastdietpescatarianleveleasykcal661

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor market-day korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.