$ cat recipes/harbor-market-day-korean-garlic-butter-breakfast-wrap-hash-029294.md

Harbor Market-Day Korean Garlic Butter Breakfast Wrap Hash

Name: Harbor Market-Day Korean Garlic Butter Breakfast Wrap Hash
Prep time: 17 min
Cook time: 11 min
Total time: 28 min
Yield: 5 servings
Ingredients: harbor market-day korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Harbor Market-Day Korean Garlic Butter Breakfast Wrap Hash is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Market-Day Korean Garlic Butter Breakfast Wrap Hash

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       17 min
cook       11 min
total      28 min
servings   5
protein    20 g
pantry     62/100

categorybreakfastdietpescatarianleveleasykcal641

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor market-day korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.