$ cat recipes/harbor-market-day-taiwanese-coconut-lime-scramble-stack-121879.md

Harbor Market-Day Taiwanese Coconut Lime Scramble Stack

Name: Harbor Market-Day Taiwanese Coconut Lime Scramble Stack
Prep time: 22 min
Cook time: 16 min
Total time: 38 min
Yield: 5 servings
Ingredients: harbor market-day taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Market-Day Taiwanese Coconut Lime Scramble Stack is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Harbor Market-Day Taiwanese Coconut Lime Scramble Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       22 min
cook       16 min
total      38 min
servings   5
protein    29 g
pantry     98/100

categorybreakfastdietpescatarianleveleasykcal206

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor market-day taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.