$ cat recipes/harbor-rainy-day-british-sesame-ginger-scramble-bake-029859.md

Harbor Rainy-Day British Sesame Ginger Scramble Bake

Name: Harbor Rainy-Day British Sesame Ginger Scramble Bake
Prep time: 18 min
Cook time: 14 min
Total time: 32 min
Yield: 5 servings
Ingredients: harbor rainy-day british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Rainy-Day British Sesame Ginger Scramble Bake is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Harbor Rainy-Day British Sesame Ginger Scramble Bake

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       18 min
cook       14 min
total      32 min
servings   5
protein    33 g
pantry     86/100

categorybreakfastdietpescatarianleveleasykcal476

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor rainy-day british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.