$ cat recipes/harbor-rainy-day-french-corn-pepper-yogurt-cup-hash-025999.md

Harbor Rainy-Day French Corn Pepper Yogurt Cup Hash

Name: Harbor Rainy-Day French Corn Pepper Yogurt Cup Hash
Prep time: 10 min
Cook time: 12 min
Total time: 22 min
Yield: 5 servings
Ingredients: harbor rainy-day french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Rainy-Day French Corn Pepper Yogurt Cup Hash is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Harbor Rainy-Day French Corn Pepper Yogurt Cup Hash

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       12 min
total      22 min
servings   5
protein    37 g
pantry     61/100

categorybreakfastdietpescatarianlevelmediumkcal246

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor rainy-day french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.